Anti CTSC pAb (ATL-HPA066610)

Atlas Antibodies

Catalog No.:
ATL-HPA066610-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cathepsin C
Gene Name: CTSC
Alternative Gene Name: DPP1, PALS, PLS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030560: 70%, ENSRNOG00000016496: 71%
Entrez Gene ID: 1075
Uniprot ID: P53634
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT
Gene Sequence SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT
Gene ID - Mouse ENSMUSG00000030560
Gene ID - Rat ENSRNOG00000016496
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTSC pAb (ATL-HPA066610)
Datasheet Anti CTSC pAb (ATL-HPA066610) Datasheet (External Link)
Vendor Page Anti CTSC pAb (ATL-HPA066610) at Atlas Antibodies

Documents & Links for Anti CTSC pAb (ATL-HPA066610)
Datasheet Anti CTSC pAb (ATL-HPA066610) Datasheet (External Link)
Vendor Page Anti CTSC pAb (ATL-HPA066610)