Anti CTSB pAb (ATL-HPA018156 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA018156-25

• 
• 

Protein Description: cathepsin B
Gene Name: CTSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021939: 79%, ENSRNOG00000010331: 79%
Entrez Gene ID: 1508
Uniprot ID: P07858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
• Gene Sequence: DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA
• Gene ID - Mouse: ENSMUSG00000021939
• Gene ID - Rat: ENSRNOG00000010331
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) – 4 Found

Kryczka, Jakub; Papiewska-Pajak, Izabela; Kowalska, M Anna; Boncela, Joanna. Cathepsin B Is Upregulated and Mediates ECM Degradation in Colon Adenocarcinoma HT29 Cells Overexpressing Snail. Cells. 2019;8(3) 

Wang, He; Chen, Yili; Fernandez-Del Castillo, Carlos; Yilmaz, Omer; Deshpande, Vikram. Heterogeneity in signaling pathways of gastroenteropancreatic neuroendocrine tumors: a critical look at notch signaling pathway. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2013;26(1):139-47. 

Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43. 

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.