Anti CTSB pAb (ATL-HPA018156 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA018156-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CTSB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021939: 79%, ENSRNOG00000010331: 79%
Entrez Gene ID: 1508
Uniprot ID: P07858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA |
| Gene Sequence | DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA |
| Gene ID - Mouse | ENSMUSG00000021939 |
| Gene ID - Rat | ENSRNOG00000010331 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) | |
| Datasheet | Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) | |
| Datasheet | Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) |
| Citations for Anti CTSB pAb (ATL-HPA018156 w/enhanced validation) – 4 Found |
| Kryczka, Jakub; Papiewska-Pajak, Izabela; Kowalska, M Anna; Boncela, Joanna. Cathepsin B Is Upregulated and Mediates ECM Degradation in Colon Adenocarcinoma HT29 Cells Overexpressing Snail. Cells. 2019;8(3) PubMed |
| Wang, He; Chen, Yili; Fernandez-Del Castillo, Carlos; Yilmaz, Omer; Deshpande, Vikram. Heterogeneity in signaling pathways of gastroenteropancreatic neuroendocrine tumors: a critical look at notch signaling pathway. Modern Pathology : An Official Journal Of The United States And Canadian Academy Of Pathology, Inc. 2013;26(1):139-47. PubMed |
| Perisic, Ljubica; Hedin, Erika; Razuvaev, Anton; Lengquist, Mariette; Osterholm, Cecilia; Folkersen, Lasse; Gillgren, Peter; Paulsson-Berne, Gabrielle; Ponten, Fredrik; Odeberg, Jacob; Hedin, Ulf. Profiling of atherosclerotic lesions by gene and tissue microarrays reveals PCSK6 as a novel protease in unstable carotid atherosclerosis. Arteriosclerosis, Thrombosis, And Vascular Biology. 2013;33(10):2432-43. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |