Anti CTSA pAb (ATL-HPA072487)

Atlas Antibodies

Catalog No.:
ATL-HPA072487-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cathepsin A
Gene Name: CTSA
Alternative Gene Name: GSL, PPGB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017760: 88%, ENSRNOG00000015857: 88%
Entrez Gene ID: 5476
Uniprot ID: P10619
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT
Gene Sequence PSMNLQGLAVGNGLSSYEQNDNSLVYFAYYHGLLGNRLWSSLQTHCCSQNKCNFYDNKDLECVTNLQEVARIVGNSGLNIYNLYAPCAGGVPSHFRYEKDTVVVQDLGNIFT
Gene ID - Mouse ENSMUSG00000017760
Gene ID - Rat ENSRNOG00000015857
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTSA pAb (ATL-HPA072487)
Datasheet Anti CTSA pAb (ATL-HPA072487) Datasheet (External Link)
Vendor Page Anti CTSA pAb (ATL-HPA072487) at Atlas Antibodies

Documents & Links for Anti CTSA pAb (ATL-HPA072487)
Datasheet Anti CTSA pAb (ATL-HPA072487) Datasheet (External Link)
Vendor Page Anti CTSA pAb (ATL-HPA072487)