Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA068122-25
  • Immunohistochemistry analysis in human urinary bladder and pancreas tissues using Anti-CTR9 antibody. Corresponding CTR9 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line RT4 shows localization to nucleoplasm.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG<br/>Lane 4: Human plasma<br/>Lane 5: Human Liver tissue<br/>Lane 6: Human Tonsil tissue
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CTR9, Paf1/RNA polymerase II complex component
Gene Name: CTR9
Alternative Gene Name: KIAA0155, p150TSP, SH2BP1, TSBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005609: 100%, ENSRNOG00000017195: 100%
Entrez Gene ID: 9646
Uniprot ID: Q6PD62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH
Gene Sequence YPDDVEAWIELAQILEQTDIQGALSAYGTATRILQEKVQADVPPEILNNVGALHFRLGNLGEAKKYFLASLDRAKAEAEH
Gene ID - Mouse ENSMUSG00000005609
Gene ID - Rat ENSRNOG00000017195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation)
Datasheet Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation)
Datasheet Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTR9 pAb (ATL-HPA068122 w/enhanced validation)