Anti CTR9 pAb (ATL-HPA061027)

Atlas Antibodies

Catalog No.:
ATL-HPA061027-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CTR9 homolog, Paf1/RNA polymerase II complex component
Gene Name: CTR9
Alternative Gene Name: KIAA0155, p150TSP, SH2BP1, TSBP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005609: 99%, ENSRNOG00000017195: 99%
Entrez Gene ID: 9646
Uniprot ID: Q6PD62
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQT
Gene Sequence NILREHPNYVDCYLRLGAMARDKGNFYEASDWFKEALQINQDHPDAWSLIGNLHLAKQEWGPGQKKFERILKQPSTQSDTYSMLALGNVWLQT
Gene ID - Mouse ENSMUSG00000005609
Gene ID - Rat ENSRNOG00000017195
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTR9 pAb (ATL-HPA061027)
Datasheet Anti CTR9 pAb (ATL-HPA061027) Datasheet (External Link)
Vendor Page Anti CTR9 pAb (ATL-HPA061027) at Atlas Antibodies

Documents & Links for Anti CTR9 pAb (ATL-HPA061027)
Datasheet Anti CTR9 pAb (ATL-HPA061027) Datasheet (External Link)
Vendor Page Anti CTR9 pAb (ATL-HPA061027)