Anti CTPS2 pAb (ATL-HPA017437)
Atlas Antibodies
- SKU:
- ATL-HPA017437-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTPS2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031360: 86%, ENSRNOG00000004257: 86%
Entrez Gene ID: 56474
Uniprot ID: Q9NRF8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD |
| Gene Sequence | GVCLGMQLAVIEFARNCLNLKDADSTEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIKQFEQNDLSFVGQDVDGD |
| Gene ID - Mouse | ENSMUSG00000031360 |
| Gene ID - Rat | ENSRNOG00000004257 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTPS2 pAb (ATL-HPA017437) | |
| Datasheet | Anti CTPS2 pAb (ATL-HPA017437) Datasheet (External Link) |
| Vendor Page | Anti CTPS2 pAb (ATL-HPA017437) at Atlas Antibodies |
| Documents & Links for Anti CTPS2 pAb (ATL-HPA017437) | |
| Datasheet | Anti CTPS2 pAb (ATL-HPA017437) Datasheet (External Link) |
| Vendor Page | Anti CTPS2 pAb (ATL-HPA017437) |
| Citations for Anti CTPS2 pAb (ATL-HPA017437) – 1 Found |
| Martin, Emmanuel; Palmic, Noé; Sanquer, Sylvia; Lenoir, Christelle; Hauck, Fabian; Mongellaz, Cédric; Fabrega, Sylvie; Nitschké, Patrick; Esposti, Mauro Degli; Schwartzentruber, Jeremy; Taylor, Naomi; Majewski, Jacek; Jabado, Nada; Wynn, Robert F; Picard, Capucine; Fischer, Alain; Arkwright, Peter D; Latour, Sylvain. CTP synthase 1 deficiency in humans reveals its central role in lymphocyte proliferation. Nature. 2014;510(7504):288-92. PubMed |