Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051322-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: CTP synthase 1
Gene Name: CTPS1
Alternative Gene Name: CTPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028633: 94%, ENSRNOG00000009963: 94%
Entrez Gene ID: 1503
Uniprot ID: P17812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Gene Sequence PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Gene ID - Mouse ENSMUSG00000028633
Gene ID - Rat ENSRNOG00000009963
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation)
Datasheet Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation)
Datasheet Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation)