Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA051322-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CTPS1
Alternative Gene Name: CTPS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028633: 94%, ENSRNOG00000009963: 94%
Entrez Gene ID: 1503
Uniprot ID: P17812
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD |
Gene Sequence | PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD |
Gene ID - Mouse | ENSMUSG00000028633 |
Gene ID - Rat | ENSRNOG00000009963 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) | |
Datasheet | Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) | |
Datasheet | Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTPS1 pAb (ATL-HPA051322 w/enhanced validation) |