Anti CTNS pAb (ATL-HPA046947)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046947-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: CTNS
Alternative Gene Name: CTNS-LSB, PQLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005949: 96%, ENSRNOG00000028688: 96%
Entrez Gene ID: 1497
Uniprot ID: O60931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF | 
| Gene Sequence | FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF | 
| Gene ID - Mouse | ENSMUSG00000005949 | 
| Gene ID - Rat | ENSRNOG00000028688 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti CTNS pAb (ATL-HPA046947) | |
| Datasheet | Anti CTNS pAb (ATL-HPA046947) Datasheet (External Link) | 
| Vendor Page | Anti CTNS pAb (ATL-HPA046947) at Atlas Antibodies | 
| Documents & Links for Anti CTNS pAb (ATL-HPA046947) | |
| Datasheet | Anti CTNS pAb (ATL-HPA046947) Datasheet (External Link) | 
| Vendor Page | Anti CTNS pAb (ATL-HPA046947) | 
 
         
                            