Anti CTNS pAb (ATL-HPA046947)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046947-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTNS
Alternative Gene Name: CTNS-LSB, PQLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005949: 96%, ENSRNOG00000028688: 96%
Entrez Gene ID: 1497
Uniprot ID: O60931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF |
Gene Sequence | FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF |
Gene ID - Mouse | ENSMUSG00000005949 |
Gene ID - Rat | ENSRNOG00000028688 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTNS pAb (ATL-HPA046947) | |
Datasheet | Anti CTNS pAb (ATL-HPA046947) Datasheet (External Link) |
Vendor Page | Anti CTNS pAb (ATL-HPA046947) at Atlas Antibodies |
Documents & Links for Anti CTNS pAb (ATL-HPA046947) | |
Datasheet | Anti CTNS pAb (ATL-HPA046947) Datasheet (External Link) |
Vendor Page | Anti CTNS pAb (ATL-HPA046947) |