Anti CTNS pAb (ATL-HPA046947)

Atlas Antibodies

Catalog No.:
ATL-HPA046947-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cystinosin, lysosomal cystine transporter
Gene Name: CTNS
Alternative Gene Name: CTNS-LSB, PQLC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005949: 96%, ENSRNOG00000028688: 96%
Entrez Gene ID: 1497
Uniprot ID: O60931
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF
Gene Sequence FPQAYMNFYYKSTEGWSIGNVLLDFTGGSFSLLQMFLQSYNNDQWTLIFGDPTKF
Gene ID - Mouse ENSMUSG00000005949
Gene ID - Rat ENSRNOG00000028688
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTNS pAb (ATL-HPA046947)
Datasheet Anti CTNS pAb (ATL-HPA046947) Datasheet (External Link)
Vendor Page Anti CTNS pAb (ATL-HPA046947) at Atlas Antibodies

Documents & Links for Anti CTNS pAb (ATL-HPA046947)
Datasheet Anti CTNS pAb (ATL-HPA046947) Datasheet (External Link)
Vendor Page Anti CTNS pAb (ATL-HPA046947)