Anti CTNND1 pAb (ATL-HPA015955 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA015955-25
  • Immunohistochemical staining of human small intestine shows cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to plasma membrane.
  • Western blot analysis in human cell lines A-431 and HEK293 using Anti-CTNND1 antibody. Corresponding CTNND1 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: catenin (cadherin-associated protein), delta 1
Gene Name: CTNND1
Alternative Gene Name: CTNND, KIAA0384, p120, p120cas, p120ctn
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101645: 98%, ENSRNOG00000030790: 98%
Entrez Gene ID: 1500
Uniprot ID: O60716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTR
Gene Sequence SVKEQEAQFEKLTRALEEERRHVSAQLERVRVSPQDANPLMANGTLTRRHQNGRFVGDADLERQKFSDLKLNGPQDHSHLLYSTIPRMQEPGQIVETYTEEDPEGAMSVVSVETSDDGTTR
Gene ID - Mouse ENSMUSG00000101645
Gene ID - Rat ENSRNOG00000030790
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CTNND1 pAb (ATL-HPA015955 w/enhanced validation)
Datasheet Anti CTNND1 pAb (ATL-HPA015955 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTNND1 pAb (ATL-HPA015955 w/enhanced validation)



Citations for Anti CTNND1 pAb (ATL-HPA015955 w/enhanced validation) – 1 Found
Ma, Wen-Ya; Song, Rui-Jie; Xu, Bin-Bin; Xu, Yan; Wang, Xiu-Xiu; Sun, Hong-Yue; Li, Shuai-Nan; Liu, Shen-Zhen; Yu, Mei-Xi; Yang, Fan; Ye, Dan-Yu; Gong, Rui; Han, Zhen-Bo; Yu, Ying; Bamba, Djibril; Wang, Ning; Pan, Zhen-Wei; Cai, Ben-Zhi. Melatonin promotes cardiomyocyte proliferation and heart repair in mice with myocardial infarction via miR-143-3p/Yap/Ctnnd1 signaling pathway. Acta Pharmacologica Sinica. 2021;42(6):921-931.  PubMed