Anti CTNND1 pAb (ATL-HPA015954 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA015954-100

• 
• 

Protein Description: catenin (cadherin-associated protein), delta 1
Gene Name: CTNND1
Alternative Gene Name: CTNND, KIAA0384, p120, p120cas, p120ctn
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000101645: 97%, ENSRNOG00000030790: 97%
Entrez Gene ID: 1500
Uniprot ID: O60716
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH
• Gene Sequence: ETTVKKVVKTVTTRTVQPVAMGPDGLPVDASSVSNNYIQTLGRDFRKNGNGGPGPYVGQAGTATLPRNFHYPPDGYSRHYEDGYPGGSDNYGSLSRVTRIEERYRPSMEGYRAPSRQDVYGPQPQVRVGGSSVDLHRFH
• Gene ID - Mouse: ENSMUSG00000101645
• Gene ID - Rat: ENSRNOG00000030790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTNND1 pAb (ATL-HPA015954 w/enhanced validation) – 1 Found

Nian, Yan; Li, Xiaorong; Ma, Jingwen; Gao, Ting; Liu, Dan. Circ_0075960 targets the miR-202-5p/CTNND1 axis to promote the growth and migration of endometrial carcinoma cells via regulating Wnt/β-catenin signaling activity. Journal Of Gynecologic Oncology. 2023;34(1):e11.