Anti CTNNBL1 pAb (ATL-HPA027906)

Atlas Antibodies

Catalog No.:
ATL-HPA027906-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: catenin beta like 1
Gene Name: CTNNBL1
Alternative Gene Name: C20orf33, FLJ21108, NAP, NYD-SP19, P14, P14L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027649: 94%, ENSRNOG00000012021: 95%
Entrez Gene ID: 56259
Uniprot ID: Q8WYA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE
Gene Sequence DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE
Gene ID - Mouse ENSMUSG00000027649
Gene ID - Rat ENSRNOG00000012021
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTNNBL1 pAb (ATL-HPA027906)
Datasheet Anti CTNNBL1 pAb (ATL-HPA027906) Datasheet (External Link)
Vendor Page Anti CTNNBL1 pAb (ATL-HPA027906) at Atlas Antibodies

Documents & Links for Anti CTNNBL1 pAb (ATL-HPA027906)
Datasheet Anti CTNNBL1 pAb (ATL-HPA027906) Datasheet (External Link)
Vendor Page Anti CTNNBL1 pAb (ATL-HPA027906)