Anti CTNNBL1 pAb (ATL-HPA027906)
Atlas Antibodies
- Catalog No.:
- ATL-HPA027906-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CTNNBL1
Alternative Gene Name: C20orf33, FLJ21108, NAP, NYD-SP19, P14, P14L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027649: 94%, ENSRNOG00000012021: 95%
Entrez Gene ID: 56259
Uniprot ID: Q8WYA6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE |
Gene Sequence | DTEEEFYLRRLDAGLFVLQHICYIMAEICNANVPQIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGLLE |
Gene ID - Mouse | ENSMUSG00000027649 |
Gene ID - Rat | ENSRNOG00000012021 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTNNBL1 pAb (ATL-HPA027906) | |
Datasheet | Anti CTNNBL1 pAb (ATL-HPA027906) Datasheet (External Link) |
Vendor Page | Anti CTNNBL1 pAb (ATL-HPA027906) at Atlas Antibodies |
Documents & Links for Anti CTNNBL1 pAb (ATL-HPA027906) | |
Datasheet | Anti CTNNBL1 pAb (ATL-HPA027906) Datasheet (External Link) |
Vendor Page | Anti CTNNBL1 pAb (ATL-HPA027906) |