Anti CTNNBIP1 pAb (ATL-HPA042617)

Atlas Antibodies

SKU:
ATL-HPA042617-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to mitochondria.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: catenin, beta interacting protein 1
Gene Name: CTNNBIP1
Alternative Gene Name: ICAT, MGC15093
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028988: 98%, ENSRNOG00000016313: 99%
Entrez Gene ID: 56998
Uniprot ID: Q9NSA3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR
Gene Sequence MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRR
Gene ID - Mouse ENSMUSG00000028988
Gene ID - Rat ENSRNOG00000016313
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTNNBIP1 pAb (ATL-HPA042617)
Datasheet Anti CTNNBIP1 pAb (ATL-HPA042617) Datasheet (External Link)
Vendor Page Anti CTNNBIP1 pAb (ATL-HPA042617) at Atlas Antibodies

Documents & Links for Anti CTNNBIP1 pAb (ATL-HPA042617)
Datasheet Anti CTNNBIP1 pAb (ATL-HPA042617) Datasheet (External Link)
Vendor Page Anti CTNNBIP1 pAb (ATL-HPA042617)