Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA029160-25

• 
• 

Protein Description: catenin (cadherin-associated protein), beta 1, 88kDa
Gene Name: CTNNB1
Alternative Gene Name: armadillo, beta-catenin, CTNNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006932: 99%, ENSRNOG00000054172: 99%
Entrez Gene ID: 1499
Uniprot ID: P35222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPD
• Gene Sequence: SEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPD
• Gene ID - Mouse: ENSMUSG00000006932
• Gene ID - Rat: ENSRNOG00000054172
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) – 3 Found

Lee, Sanghyun; Kalugotla, Gowri; Ingle, Harshad; Rodgers, Rachel; Wu, Chunyan; Wang, Yating; Li, Yuhao; Yang, Xia; Zhang, Jin; Borella, Nicolette R; Deng, Hongju; Droit, Lindsay; Hill, Ryan; Peterson, Stefan T; Desai, Chandni; Lawrence, Dylan; Lu, Qun; Baldridge, Megan T. Intestinal antiviral signaling is controlled by autophagy gene Epg5 independent of the microbiota. Autophagy. 2022;18(5):1062-1077. 

Xiong, Yujing; Hu, Linli; Zhang, Tao; Wang, Mengying; Xu, Hui; Li, Tin Chiu; Sun, Yingpu; Wang, Chi Chiu. Effects of high progesterone in in-vitro fertilization cycle on DNA methylation and gene expression of adhesion molecules on endometrium during implantation window. Journal Of Assisted Reproduction And Genetics. 2020;37(1):33-43. 

Weeks, Shannon E; Kammerud, Sarah C; Metge, Brandon J; AlSheikh, Heba A; Schneider, David A; Chen, Dongquan; Wei, Shi; Mobley, James A; Ojesina, Akinyemi I; Shevde, Lalita A; Samant, Rajeev S. Inhibiting β-catenin disables nucleolar functions in triple-negative breast cancer. Cell Death & Disease. 2021;12(3):242.