Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA029160-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CTNNB1
Alternative Gene Name: armadillo, beta-catenin, CTNNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006932: 99%, ENSRNOG00000054172: 99%
Entrez Gene ID: 1499
Uniprot ID: P35222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPD |
Gene Sequence | SEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPD |
Gene ID - Mouse | ENSMUSG00000006932 |
Gene ID - Rat | ENSRNOG00000054172 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) | |
Datasheet | Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) | |
Datasheet | Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) |
Citations for Anti CTNNB1 pAb (ATL-HPA029160 w/enhanced validation) – 3 Found |
Lee, Sanghyun; Kalugotla, Gowri; Ingle, Harshad; Rodgers, Rachel; Wu, Chunyan; Wang, Yating; Li, Yuhao; Yang, Xia; Zhang, Jin; Borella, Nicolette R; Deng, Hongju; Droit, Lindsay; Hill, Ryan; Peterson, Stefan T; Desai, Chandni; Lawrence, Dylan; Lu, Qun; Baldridge, Megan T. Intestinal antiviral signaling is controlled by autophagy gene Epg5 independent of the microbiota. Autophagy. 2022;18(5):1062-1077. PubMed |
Xiong, Yujing; Hu, Linli; Zhang, Tao; Wang, Mengying; Xu, Hui; Li, Tin Chiu; Sun, Yingpu; Wang, Chi Chiu. Effects of high progesterone in in-vitro fertilization cycle on DNA methylation and gene expression of adhesion molecules on endometrium during implantation window. Journal Of Assisted Reproduction And Genetics. 2020;37(1):33-43. PubMed |
Weeks, Shannon E; Kammerud, Sarah C; Metge, Brandon J; AlSheikh, Heba A; Schneider, David A; Chen, Dongquan; Wei, Shi; Mobley, James A; Ojesina, Akinyemi I; Shevde, Lalita A; Samant, Rajeev S. Inhibiting β-catenin disables nucleolar functions in triple-negative breast cancer. Cell Death & Disease. 2021;12(3):242. PubMed |