Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA029159-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: catenin (cadherin-associated protein), beta 1, 88kDa
Gene Name: CTNNB1
Alternative Gene Name: armadillo, beta-catenin, CTNNB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006932: 100%, ENSRNOG00000054172: 100%
Entrez Gene ID: 1499
Uniprot ID: P35222
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Gene Sequence SYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAH
Gene ID - Mouse ENSMUSG00000006932
Gene ID - Rat ENSRNOG00000054172
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation)
Datasheet Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation)
Datasheet Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation)
Citations for Anti CTNNB1 pAb (ATL-HPA029159 w/enhanced validation) – 4 Found
Albanese, Isabella; Daskalopoulou, Stella S; Yu, Bin; You, Zhipeng; Genest, Jacques; Alsheikh-Ali, Alawi; Schwertani, Adel G. The Urotensin II System and Carotid Atherosclerosis: A Role in Vascular Calcification. Frontiers In Pharmacology. 7( 27375483):149.  PubMed
Klein, Donna; Goldberg, Shalom; Theile, Christopher S; Dambra, Richard; Haskell, Kathleen; Kuhar, Elise; Lin, Tricia; Parmar, Rubina; Manoharan, Muthiah; Richter, Mark; Wu, Meizhen; Mendrola Zarazowski, Jeannine; Jadhav, Vasant; Maier, Martin A; Sepp-Lorenzino, Laura; O'Neil, Karyn; Dudkin, Vadim. Centyrin ligands for extrahepatic delivery of siRNA. Molecular Therapy : The Journal Of The American Society Of Gene Therapy. 2021;29(6):2053-2066.  PubMed
Tian, Bing; Widen, Steven G; Yang, Jun; Wood, Thomas G; Kudlicki, Andrzej; Zhao, Yingxin; Brasier, Allan R. The NFκB subunit RELA is a master transcriptional regulator of the committed epithelial-mesenchymal transition in airway epithelial cells. The Journal Of Biological Chemistry. 2018;293(42):16528-16545.  PubMed
Khan, Kashif; Yu, Bin; Kiwan, Chrystina; Shalal, Yousif; Filimon, Sabin; Cipro, Megan; Shum-Tim, Dominique; Cecere, Renzo; Schwertani, Adel. The Role of Wnt/β-Catenin Pathway Mediators in Aortic Valve Stenosis. Frontiers In Cell And Developmental Biology. 8( 33015048):862.  PubMed