Anti CTNNA1 pAb (ATL-HPA046119)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046119-100
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: CTNNA1
Alternative Gene Name: CAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037815: 100%, ENSRNOG00000005796: 98%
Entrez Gene ID: 1495
Uniprot ID: P35221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
Gene Sequence | LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK |
Gene ID - Mouse | ENSMUSG00000037815 |
Gene ID - Rat | ENSRNOG00000005796 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119) | |
Datasheet | Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link) |
Vendor Page | Anti CTNNA1 pAb (ATL-HPA046119) at Atlas Antibodies |
Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119) | |
Datasheet | Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link) |
Vendor Page | Anti CTNNA1 pAb (ATL-HPA046119) |
Citations for Anti CTNNA1 pAb (ATL-HPA046119) – 1 Found |
Duś-Szachniewicz, Kamila; Drobczyński, Sławomir; Ziółkowski, Piotr; Kołodziej, Paweł; Walaszek, Kinga M; Korzeniewska, Aleksandra K; Agrawal, Anil; Kupczyk, Piotr; Woźniak, Marta. Physiological Hypoxia (Physioxia) Impairs the Early Adhesion of Single Lymphoma Cell to Marrow Stromal Cell and Extracellular Matrix. Optical Tweezers Study. International Journal Of Molecular Sciences. 2018;19(7) PubMed |