Anti CTNNA1 pAb (ATL-HPA046119)

Atlas Antibodies

Catalog No.:
ATL-HPA046119-100
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: catenin (cadherin-associated protein), alpha 1, 102kDa
Gene Name: CTNNA1
Alternative Gene Name: CAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037815: 100%, ENSRNOG00000005796: 98%
Entrez Gene ID: 1495
Uniprot ID: P35221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK
Gene Sequence LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK
Gene ID - Mouse ENSMUSG00000037815
Gene ID - Rat ENSRNOG00000005796
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119)
Datasheet Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link)
Vendor Page Anti CTNNA1 pAb (ATL-HPA046119) at Atlas Antibodies

Documents & Links for Anti CTNNA1 pAb (ATL-HPA046119)
Datasheet Anti CTNNA1 pAb (ATL-HPA046119) Datasheet (External Link)
Vendor Page Anti CTNNA1 pAb (ATL-HPA046119)
Citations for Anti CTNNA1 pAb (ATL-HPA046119) – 1 Found
Duś-Szachniewicz, Kamila; Drobczyński, Sławomir; Ziółkowski, Piotr; Kołodziej, Paweł; Walaszek, Kinga M; Korzeniewska, Aleksandra K; Agrawal, Anil; Kupczyk, Piotr; Woźniak, Marta. Physiological Hypoxia (Physioxia) Impairs the Early Adhesion of Single Lymphoma Cell to Marrow Stromal Cell and Extracellular Matrix. Optical Tweezers Study. International Journal Of Molecular Sciences. 2018;19(7)  PubMed