Anti CTNNA1 pAb (ATL-HPA046119)

Atlas Antibodies

Catalog No.: ATL-HPA046119-100

Protein Description: catenin (cadherin-associated protein), alpha 1, 102kDa
Gene Name: CTNNA1
Alternative Gene Name: CAP102
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037815: 100%, ENSRNOG00000005796: 98%
Entrez Gene ID: 1495
Uniprot ID: P35221
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK
• Gene Sequence: LADMADVYKLLVQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAK
• Gene ID - Mouse: ENSMUSG00000037815
• Gene ID - Rat: ENSRNOG00000005796
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTNNA1 pAb (ATL-HPA046119) – 1 Found

Duś-Szachniewicz, Kamila; Drobczyński, Sławomir; Ziółkowski, Piotr; Kołodziej, Paweł; Walaszek, Kinga M; Korzeniewska, Aleksandra K; Agrawal, Anil; Kupczyk, Piotr; Woźniak, Marta. Physiological Hypoxia (Physioxia) Impairs the Early Adhesion of Single Lymphoma Cell to Marrow Stromal Cell and Extracellular Matrix. Optical Tweezers Study. International Journal Of Molecular Sciences. 2018;19(7)