Anti CTIF pAb (ATL-HPA016865)
Atlas Antibodies
- Catalog No.:
- ATL-HPA016865-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTIF
Alternative Gene Name: KIAA0427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052928: 96%, ENSRNOG00000018342: 94%
Entrez Gene ID: 9811
Uniprot ID: O43310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFR |
| Gene Sequence | TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFR |
| Gene ID - Mouse | ENSMUSG00000052928 |
| Gene ID - Rat | ENSRNOG00000018342 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTIF pAb (ATL-HPA016865) | |
| Datasheet | Anti CTIF pAb (ATL-HPA016865) Datasheet (External Link) |
| Vendor Page | Anti CTIF pAb (ATL-HPA016865) at Atlas Antibodies |
| Documents & Links for Anti CTIF pAb (ATL-HPA016865) | |
| Datasheet | Anti CTIF pAb (ATL-HPA016865) Datasheet (External Link) |
| Vendor Page | Anti CTIF pAb (ATL-HPA016865) |
| Citations for Anti CTIF pAb (ATL-HPA016865) – 1 Found |
| Dankert, John F; Pagan, Julia K; Starostina, Natalia G; Kipreos, Edward T; Pagano, Michele. FEM1 proteins are ancient regulators of SLBP degradation. Cell Cycle (Georgetown, Tex.). 2017;16(6):556-564. PubMed |