Anti CTIF pAb (ATL-HPA016865)

Atlas Antibodies

SKU: ATL-HPA016865-25

• 
• 
• 

Protein Description: CBP80/20-dependent translation initiation factor
Gene Name: CTIF
Alternative Gene Name: KIAA0427
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052928: 96%, ENSRNOG00000018342: 94%
Entrez Gene ID: 9811
Uniprot ID: O43310
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFR
• Gene Sequence: TFDSFSGATWDLQPEKLDFTQFHRKVRHTPKQPLPHIDREGCGKGKLEDGDGINLNDIEKVLPAWQGYHPMPHEVEIAHTKKLFR
• Gene ID - Mouse: ENSMUSG00000052928
• Gene ID - Rat: ENSRNOG00000018342
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTIF pAb (ATL-HPA016865) – 1 Found

Dankert, John F; Pagan, Julia K; Starostina, Natalia G; Kipreos, Edward T; Pagano, Michele. FEM1 proteins are ancient regulators of SLBP degradation. Cell Cycle (Georgetown, Tex.). 2017;16(6):556-564.