Anti CTHRC1 pAb (ATL-HPA061896)

Atlas Antibodies

Catalog No.:
ATL-HPA061896-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: collagen triple helix repeat containing 1
Gene Name: CTHRC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106929: 100%, ENSRNOG00000004578: 100%
Entrez Gene ID: 115908
Uniprot ID: Q96CG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPI
Gene Sequence QCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPI
Gene ID - Mouse ENSMUSG00000106929
Gene ID - Rat ENSRNOG00000004578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTHRC1 pAb (ATL-HPA061896)
Datasheet Anti CTHRC1 pAb (ATL-HPA061896) Datasheet (External Link)
Vendor Page Anti CTHRC1 pAb (ATL-HPA061896) at Atlas Antibodies

Documents & Links for Anti CTHRC1 pAb (ATL-HPA061896)
Datasheet Anti CTHRC1 pAb (ATL-HPA061896) Datasheet (External Link)
Vendor Page Anti CTHRC1 pAb (ATL-HPA061896)