Anti CTHRC1 pAb (ATL-HPA061896)
Atlas Antibodies
- SKU:
- ATL-HPA061896-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTHRC1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000106929: 100%, ENSRNOG00000004578: 100%
Entrez Gene ID: 115908
Uniprot ID: Q96CG8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | QCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPI |
Gene Sequence | QCSWSSLNYGIDLGKIAECTFTKMRSNSALRVLFSGSLRLKCRNACCQRWYFTFNGAECSGPLPI |
Gene ID - Mouse | ENSMUSG00000106929 |
Gene ID - Rat | ENSRNOG00000004578 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTHRC1 pAb (ATL-HPA061896) | |
Datasheet | Anti CTHRC1 pAb (ATL-HPA061896) Datasheet (External Link) |
Vendor Page | Anti CTHRC1 pAb (ATL-HPA061896) at Atlas Antibodies |
Documents & Links for Anti CTHRC1 pAb (ATL-HPA061896) | |
Datasheet | Anti CTHRC1 pAb (ATL-HPA061896) Datasheet (External Link) |
Vendor Page | Anti CTHRC1 pAb (ATL-HPA061896) |