Anti CTH pAb (ATL-HPA023300 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023300-25

• 
• 

Protein Description: cystathionine gamma-lyase
Gene Name: CTH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028179: 84%, ENSRNOG00000010658: 85%
Entrez Gene ID: 1491
Uniprot ID: P32929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
• Gene Sequence: TGCTGMVTFYIKGTLQHAEIFLKNLKLFTLAESLGGFESLAELPAIMTHASVLKNDRDVLGISDTLIRLSVGLEDEEDLLEDLDQALKAAHP
• Gene ID - Mouse: ENSMUSG00000028179
• Gene ID - Rat: ENSRNOG00000010658
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTH pAb (ATL-HPA023300 w/enhanced validation) – 2 Found

Teng, P-N; Wang, G; Hood, B L; Conrads, K A; Hamilton, C A; Maxwell, G L; Darcy, K M; Conrads, T P. Identification of candidate circulating cisplatin-resistant biomarkers from epithelial ovarian carcinoma cell secretomes. British Journal Of Cancer. 2014;110(1):123-32. 

Gao, Xing-Huang; Li, Ling; Parisien, Marc; Wu, Jing; Bederman, Ilya; Gao, Zhaofeng; Krokowski, Dawid; Chirieleison, Steven M; Abbott, Derek; Wang, Benlian; Arvan, Peter; Cameron, Mark; Chance, Mark; Willard, Belinda; Hatzoglou, Maria. Discovery of a Redox Thiol Switch: Implications for Cellular Energy Metabolism. Molecular & Cellular Proteomics : Mcp. 2020;19(5):852-870.