Anti CTH pAb (ATL-HPA021591 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA021591-25
  • Immunohistochemistry analysis in human liver and lymph node tissues using Anti-CTH antibody. Corresponding CTH RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cystathionine gamma-lyase
Gene Name: CTH
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028179: 87%, ENSRNOG00000057089: 86%
Entrez Gene ID: 1491
Uniprot ID: P32929
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD
Gene Sequence KAGDQIICMDDVYGGTNRYFRQVASEFGLKISFVDCSKIKLLEAAITPETKLVWIETPTNPTQKVIDIEGCAHIVHKHGDIILVVDNTFMSPYFQRPLALGAD
Gene ID - Mouse ENSMUSG00000028179
Gene ID - Rat ENSRNOG00000057089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTH pAb (ATL-HPA021591 w/enhanced validation)
Datasheet Anti CTH pAb (ATL-HPA021591 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTH pAb (ATL-HPA021591 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTH pAb (ATL-HPA021591 w/enhanced validation)
Datasheet Anti CTH pAb (ATL-HPA021591 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTH pAb (ATL-HPA021591 w/enhanced validation)