Anti CTDSPL2 pAb (ATL-HPA062198)

Atlas Antibodies

SKU:
ATL-HPA062198-25
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase like 2
Gene Name: CTDSPL2
Alternative Gene Name: FLJ10523, HSPC129
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033411: 97%, ENSRNOG00000022141: 97%
Entrez Gene ID: 51496
Uniprot ID: Q05D32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTS
Gene Sequence RRKSQVNGEAGSYEMTNQHVKQNGKLEDNPSSGSPPRTTLLGTIFSPVFNFFSPANKNGTSGSDSPGQAVEAEEIVKQLDMEQVDEITTS
Gene ID - Mouse ENSMUSG00000033411
Gene ID - Rat ENSRNOG00000022141
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTDSPL2 pAb (ATL-HPA062198)
Datasheet Anti CTDSPL2 pAb (ATL-HPA062198) Datasheet (External Link)
Vendor Page Anti CTDSPL2 pAb (ATL-HPA062198) at Atlas Antibodies

Documents & Links for Anti CTDSPL2 pAb (ATL-HPA062198)
Datasheet Anti CTDSPL2 pAb (ATL-HPA062198) Datasheet (External Link)
Vendor Page Anti CTDSPL2 pAb (ATL-HPA062198)