Anti CTDSP2 pAb (ATL-HPA052607)

Atlas Antibodies

SKU:
ATL-HPA052607-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2
Gene Name: CTDSP2
Alternative Gene Name: OS4, PSR2, SCP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078429: 89%, ENSRNOG00000047598: 89%
Entrez Gene ID: 10106
Uniprot ID: O14595
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVID
Gene Sequence CCFRAQHVGQSSSSTELAAYKEEANTIAKSDLLQCLQYQFYQIPGTCLLPEVTEEDQGRICVVID
Gene ID - Mouse ENSMUSG00000078429
Gene ID - Rat ENSRNOG00000047598
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTDSP2 pAb (ATL-HPA052607)
Datasheet Anti CTDSP2 pAb (ATL-HPA052607) Datasheet (External Link)
Vendor Page Anti CTDSP2 pAb (ATL-HPA052607) at Atlas Antibodies

Documents & Links for Anti CTDSP2 pAb (ATL-HPA052607)
Datasheet Anti CTDSP2 pAb (ATL-HPA052607) Datasheet (External Link)
Vendor Page Anti CTDSP2 pAb (ATL-HPA052607)