Anti CTDSP1 pAb (ATL-HPA062654)

Atlas Antibodies

Catalog No.: ATL-HPA062654-25

Protein Description: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1
Gene Name: CTDSP1
Alternative Gene Name: NLIIF, SCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026176: 95%, ENSRNOG00000015295: 93%
Entrez Gene ID: 58190
Uniprot ID: Q9GZU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV
• Gene Sequence: EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV
• Gene ID - Mouse: ENSMUSG00000026176
• Gene ID - Rat: ENSRNOG00000015295
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.