Anti CTDSP1 pAb (ATL-HPA062654)

Atlas Antibodies

Catalog No.:
ATL-HPA062654-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1
Gene Name: CTDSP1
Alternative Gene Name: NLIIF, SCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026176: 95%, ENSRNOG00000015295: 93%
Entrez Gene ID: 58190
Uniprot ID: Q9GZU7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV
Gene Sequence EALPAHSGAPLLVEENGAIPKQTPVQYLLPEAKAQDSDKICVV
Gene ID - Mouse ENSMUSG00000026176
Gene ID - Rat ENSRNOG00000015295
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTDSP1 pAb (ATL-HPA062654)
Datasheet Anti CTDSP1 pAb (ATL-HPA062654) Datasheet (External Link)
Vendor Page Anti CTDSP1 pAb (ATL-HPA062654) at Atlas Antibodies

Documents & Links for Anti CTDSP1 pAb (ATL-HPA062654)
Datasheet Anti CTDSP1 pAb (ATL-HPA062654) Datasheet (External Link)
Vendor Page Anti CTDSP1 pAb (ATL-HPA062654)