Anti CTDP1 pAb (ATL-HPA070389)

Atlas Antibodies

SKU:
ATL-HPA070389-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CTD phosphatase subunit 1
Gene Name: CTDP1
Alternative Gene Name: FCP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033323: 91%, ENSRNOG00000061474: 88%
Entrez Gene ID: 9150
Uniprot ID: Q9Y5B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTK
Gene Sequence IFSGLHPTNFPIEKTREHYHATALGAKILTRLVLSPDAPDRATHLIAARAGTEKVLQAQECGHLHVVNPDWLWSCLERWDKVEEQLFPLRDDHTK
Gene ID - Mouse ENSMUSG00000033323
Gene ID - Rat ENSRNOG00000061474
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CTDP1 pAb (ATL-HPA070389)
Datasheet Anti CTDP1 pAb (ATL-HPA070389) Datasheet (External Link)
Vendor Page Anti CTDP1 pAb (ATL-HPA070389) at Atlas Antibodies

Documents & Links for Anti CTDP1 pAb (ATL-HPA070389)
Datasheet Anti CTDP1 pAb (ATL-HPA070389) Datasheet (External Link)
Vendor Page Anti CTDP1 pAb (ATL-HPA070389)