Anti CTDNEP1 pAb (ATL-HPA066466)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066466-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CTDNEP1
Alternative Gene Name: DULLARD, HSA011916, NET56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018559: 98%, ENSRNOG00000017352: 98%
Entrez Gene ID: 23399
Uniprot ID: O95476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG |
| Gene Sequence | QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG |
| Gene ID - Mouse | ENSMUSG00000018559 |
| Gene ID - Rat | ENSRNOG00000017352 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTDNEP1 pAb (ATL-HPA066466) | |
| Datasheet | Anti CTDNEP1 pAb (ATL-HPA066466) Datasheet (External Link) |
| Vendor Page | Anti CTDNEP1 pAb (ATL-HPA066466) at Atlas Antibodies |
| Documents & Links for Anti CTDNEP1 pAb (ATL-HPA066466) | |
| Datasheet | Anti CTDNEP1 pAb (ATL-HPA066466) Datasheet (External Link) |
| Vendor Page | Anti CTDNEP1 pAb (ATL-HPA066466) |