Anti CTDNEP1 pAb (ATL-HPA066466)

Atlas Antibodies

Catalog No.:
ATL-HPA066466-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CTD nuclear envelope phosphatase 1
Gene Name: CTDNEP1
Alternative Gene Name: DULLARD, HSA011916, NET56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018559: 98%, ENSRNOG00000017352: 98%
Entrez Gene ID: 23399
Uniprot ID: O95476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG
Gene Sequence QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG
Gene ID - Mouse ENSMUSG00000018559
Gene ID - Rat ENSRNOG00000017352
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTDNEP1 pAb (ATL-HPA066466)
Datasheet Anti CTDNEP1 pAb (ATL-HPA066466) Datasheet (External Link)
Vendor Page Anti CTDNEP1 pAb (ATL-HPA066466) at Atlas Antibodies

Documents & Links for Anti CTDNEP1 pAb (ATL-HPA066466)
Datasheet Anti CTDNEP1 pAb (ATL-HPA066466) Datasheet (External Link)
Vendor Page Anti CTDNEP1 pAb (ATL-HPA066466)