Anti CTDNEP1 pAb (ATL-HPA037439)
Atlas Antibodies
- Catalog No.:
- ATL-HPA037439-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTDNEP1
Alternative Gene Name: DULLARD, HSA011916, NET56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018559: 100%, ENSRNOG00000017352: 100%
Entrez Gene ID: 23399
Uniprot ID: O95476
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLS |
Gene Sequence | YIKDLSVVHSDLSSIVILDNSPGAYRSHPDNAIPIKSWFSDPSDTALLNLLPMLDALRFTADVRSVLS |
Gene ID - Mouse | ENSMUSG00000018559 |
Gene ID - Rat | ENSRNOG00000017352 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTDNEP1 pAb (ATL-HPA037439) | |
Datasheet | Anti CTDNEP1 pAb (ATL-HPA037439) Datasheet (External Link) |
Vendor Page | Anti CTDNEP1 pAb (ATL-HPA037439) at Atlas Antibodies |
Documents & Links for Anti CTDNEP1 pAb (ATL-HPA037439) | |
Datasheet | Anti CTDNEP1 pAb (ATL-HPA037439) Datasheet (External Link) |
Vendor Page | Anti CTDNEP1 pAb (ATL-HPA037439) |