Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001472-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CTCFL
Alternative Gene Name: BORIS, CT27, dJ579F20.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070495: 36%, ENSRNOG00000028661: 36%
Entrez Gene ID: 140690
Uniprot ID: Q8NI51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC, ChIP-Exo-Seq |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS |
Gene Sequence | DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS |
Gene ID - Mouse | ENSMUSG00000070495 |
Gene ID - Rat | ENSRNOG00000028661 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) | |
Datasheet | Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) | |
Datasheet | Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) |
Citations for Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) – 6 Found |
Asano, Takuya; Hirohashi, Yoshihiko; Torigoe, Toshihiko; Mariya, Tasuku; Horibe, Ryota; Kuroda, Takafumi; Tabuchi, Yuta; Saijo, Hiroshi; Yasuda, Kazuyo; Mizuuchi, Masahito; Takahashi, Akari; Asanuma, Hiroko; Hasegawa, Tadashi; Saito, Tsuyoshi; Sato, Noriyuki. Brother of the regulator of the imprinted site (BORIS) variant subfamily 6 is involved in cervical cancer stemness and can be a target of immunotherapy. Oncotarget. 2016;7(10):11223-37. PubMed |
Salgado-Albarrán, Marisol; Späth, Julian; González-Barrios, Rodrigo; Baumbach, Jan; Soto-Reyes, Ernesto. CTCFL regulates the PI3K-Akt pathway and it is a target for personalized ovarian cancer therapy. Npj Systems Biology And Applications. 2022;8(1):5. PubMed |
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300. PubMed |
Hines, William C; Bazarov, Alexey V; Mukhopadhyay, Rituparna; Yaswen, Paul. BORIS (CTCFL) is not expressed in most human breast cell lines and high grade breast carcinomas. Plos One. 2010;5(3):e9738. PubMed |
Jones, Tania A; Ogunkolade, Babatunji W; Szary, Jaroslaw; Aarum, Johan; Mumin, Muhammad A; Patel, Shyam; Pieri, Christopher A; Sheer, Denise. Widespread expression of BORIS/CTCFL in normal and cancer cells. Plos One. 6(7):e22399. PubMed |
Freitas, Marcelo; Malheiros, Suzana; Stávale, João Norberto; Biassi, Thais Priscila; Zamunér, Fernando Tadeu; de Souza Begnami, Maria; Soares, Fernando Augusto; Vettore, Andre Luíz. Expression of cancer/testis antigens is correlated with improved survival in glioblastoma. Oncotarget. 2013;4(4):636-46. PubMed |