Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA001472-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CCCTC-binding factor (zinc finger protein)-like
Gene Name: CTCFL
Alternative Gene Name: BORIS, CT27, dJ579F20.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070495: 36%, ENSRNOG00000028661: 36%
Entrez Gene ID: 140690
Uniprot ID: Q8NI51
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Gene Sequence DGVCREKDHRSPSELEAQRTSGAFQDSVLEEEVELVLAPSEESEKYILTLQTVHFTSEAVELQDMSLLSIQQQEGVQVVVQQPGPGLLWLEEGPRQSLQQCVAISIQQELYSPQEMEVLQFHALEENVMVASEDSKLAVS
Gene ID - Mouse ENSMUSG00000070495
Gene ID - Rat ENSRNOG00000028661
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation)
Datasheet Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation)
Datasheet Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation)
Citations for Anti CTCFL pAb (ATL-HPA001472 w/enhanced validation) – 6 Found
Asano, Takuya; Hirohashi, Yoshihiko; Torigoe, Toshihiko; Mariya, Tasuku; Horibe, Ryota; Kuroda, Takafumi; Tabuchi, Yuta; Saijo, Hiroshi; Yasuda, Kazuyo; Mizuuchi, Masahito; Takahashi, Akari; Asanuma, Hiroko; Hasegawa, Tadashi; Saito, Tsuyoshi; Sato, Noriyuki. Brother of the regulator of the imprinted site (BORIS) variant subfamily 6 is involved in cervical cancer stemness and can be a target of immunotherapy. Oncotarget. 2016;7(10):11223-37.  PubMed
Salgado-Albarrán, Marisol; Späth, Julian; González-Barrios, Rodrigo; Baumbach, Jan; Soto-Reyes, Ernesto. CTCFL regulates the PI3K-Akt pathway and it is a target for personalized ovarian cancer therapy. Npj Systems Biology And Applications. 2022;8(1):5.  PubMed
Bolander, Asa; Agnarsdóttir, Margrét; Strömberg, Sara; Ponten, Fredrik; Hesselius, Patrik; Uhlen, Mathias; Bergqvist, Michael. The protein expression of TRP-1 and galectin-1 in cutaneous malignant melanomas. Cancer Genomics & Proteomics. 2008;5(6):293-300.  PubMed
Hines, William C; Bazarov, Alexey V; Mukhopadhyay, Rituparna; Yaswen, Paul. BORIS (CTCFL) is not expressed in most human breast cell lines and high grade breast carcinomas. Plos One. 2010;5(3):e9738.  PubMed
Jones, Tania A; Ogunkolade, Babatunji W; Szary, Jaroslaw; Aarum, Johan; Mumin, Muhammad A; Patel, Shyam; Pieri, Christopher A; Sheer, Denise. Widespread expression of BORIS/CTCFL in normal and cancer cells. Plos One. 6(7):e22399.  PubMed
Freitas, Marcelo; Malheiros, Suzana; Stávale, João Norberto; Biassi, Thais Priscila; Zamunér, Fernando Tadeu; de Souza Begnami, Maria; Soares, Fernando Augusto; Vettore, Andre Luíz. Expression of cancer/testis antigens is correlated with improved survival in glioblastoma. Oncotarget. 2013;4(4):636-46.  PubMed