Anti CTCF pAb (ATL-HPA004122)

Atlas Antibodies

Catalog No.:
ATL-HPA004122-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CCCTC-binding factor (zinc finger protein)
Gene Name: CTCF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005698: 99%, ENSRNOG00000017674: 100%
Entrez Gene ID: 10664
Uniprot ID: P49711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC, ChIP-Exo-Seq
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Gene Sequence QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP
Gene ID - Mouse ENSMUSG00000005698
Gene ID - Rat ENSRNOG00000017674
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTCF pAb (ATL-HPA004122)
Datasheet Anti CTCF pAb (ATL-HPA004122) Datasheet (External Link)
Vendor Page Anti CTCF pAb (ATL-HPA004122) at Atlas Antibodies

Documents & Links for Anti CTCF pAb (ATL-HPA004122)
Datasheet Anti CTCF pAb (ATL-HPA004122) Datasheet (External Link)
Vendor Page Anti CTCF pAb (ATL-HPA004122)
Citations for Anti CTCF pAb (ATL-HPA004122) – 1 Found
Höflmayer, Doris; Steinhoff, Amélie; Hube-Magg, Claudia; Kluth, Martina; Simon, Ronald; Burandt, Eike; Tsourlakis, Maria Christina; Minner, Sarah; Sauter, Guido; Büscheck, Franziska; Wilczak, Waldemar; Steurer, Stefan; Huland, Hartwig; Graefen, Markus; Haese, Alexander; Heinzer, Hans; Schlomm, Thorsten; Jacobsen, Frank; Hinsch, Andrea; Poos, Alexandra M; Oswald, Marcus; Rippe, Karsten; König, Rainer; Schroeder, Cornelia. Expression of CCCTC-binding factor (CTCF) is linked to poor prognosis in prostate cancer. Molecular Oncology. 2020;14(1):129-138.  PubMed