Anti CTCF pAb (ATL-HPA004122)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004122-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CTCF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005698: 99%, ENSRNOG00000017674: 100%
Entrez Gene ID: 10664
Uniprot ID: P49711
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC, ChIP-Exo-Seq |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP |
| Gene Sequence | QNQTDGGEVVQDVNSSVQMVMMEQLDPTLLQMKTEVMEGTVAPEAEAAVDDTQIITLQVVNMEEQPINIGELQLVQVPVPVTVPVATTSVEELQGAYENEVSKEGLAESEPMICHTLPLPEGFQVVKVGANGEVETLEQGELPPQEDP |
| Gene ID - Mouse | ENSMUSG00000005698 |
| Gene ID - Rat | ENSRNOG00000017674 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTCF pAb (ATL-HPA004122) | |
| Datasheet | Anti CTCF pAb (ATL-HPA004122) Datasheet (External Link) |
| Vendor Page | Anti CTCF pAb (ATL-HPA004122) at Atlas Antibodies |
| Documents & Links for Anti CTCF pAb (ATL-HPA004122) | |
| Datasheet | Anti CTCF pAb (ATL-HPA004122) Datasheet (External Link) |
| Vendor Page | Anti CTCF pAb (ATL-HPA004122) |
| Citations for Anti CTCF pAb (ATL-HPA004122) – 1 Found |
| Höflmayer, Doris; Steinhoff, Amélie; Hube-Magg, Claudia; Kluth, Martina; Simon, Ronald; Burandt, Eike; Tsourlakis, Maria Christina; Minner, Sarah; Sauter, Guido; Büscheck, Franziska; Wilczak, Waldemar; Steurer, Stefan; Huland, Hartwig; Graefen, Markus; Haese, Alexander; Heinzer, Hans; Schlomm, Thorsten; Jacobsen, Frank; Hinsch, Andrea; Poos, Alexandra M; Oswald, Marcus; Rippe, Karsten; König, Rainer; Schroeder, Cornelia. Expression of CCCTC-binding factor (CTCF) is linked to poor prognosis in prostate cancer. Molecular Oncology. 2020;14(1):129-138. PubMed |