Anti CTC-534A2.2 pAb (ATL-HPA068764)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068764-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CTC-534A2.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044581: 27%, ENSRNOG00000042482: 26%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCT |
| Gene Sequence | HDAKSHSYDCTVDLLEFQPSLKKQHLTWSHTLKEQTNSGNLGKQSEKGKQHKRRSWSISLPSNNCT |
| Gene ID - Mouse | ENSMUSG00000044581 |
| Gene ID - Rat | ENSRNOG00000042482 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA068764) | |
| Datasheet | Anti CTC-534A2.2 pAb (ATL-HPA068764) Datasheet (External Link) |
| Vendor Page | Anti CTC-534A2.2 pAb (ATL-HPA068764) at Atlas Antibodies |
| Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA068764) | |
| Datasheet | Anti CTC-534A2.2 pAb (ATL-HPA068764) Datasheet (External Link) |
| Vendor Page | Anti CTC-534A2.2 pAb (ATL-HPA068764) |