Anti CTC-534A2.2 pAb (ATL-HPA066071)

Atlas Antibodies

Catalog No.:
ATL-HPA066071-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description:
Gene Name: CTC-534A2.2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034731: 29%, ENSRNOG00000010065: 29%
Entrez Gene ID:
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEH
Gene Sequence TEVILHYRPCESDPTQLPKIAEKAIQDFPTRPLSRFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLTISEH
Gene ID - Mouse ENSMUSG00000034731
Gene ID - Rat ENSRNOG00000010065
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA066071)
Datasheet Anti CTC-534A2.2 pAb (ATL-HPA066071) Datasheet (External Link)
Vendor Page Anti CTC-534A2.2 pAb (ATL-HPA066071) at Atlas Antibodies

Documents & Links for Anti CTC-534A2.2 pAb (ATL-HPA066071)
Datasheet Anti CTC-534A2.2 pAb (ATL-HPA066071) Datasheet (External Link)
Vendor Page Anti CTC-534A2.2 pAb (ATL-HPA066071)