Anti CTBS pAb (ATL-HPA023594)

Atlas Antibodies

Catalog No.:
ATL-HPA023594-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: chitobiase, di-N-acetyl-
Gene Name: CTBS
Alternative Gene Name: CTB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028189: 88%, ENSRNOG00000015573: 85%
Entrez Gene ID: 1486
Uniprot ID: Q01459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFV
Gene Sequence VSLKDIIDPAFRASWIAQKLNLAKTQYMDGINIDIEQEVNCLSPEYDALTALVKETTDSFHREIEGSQVTFDVAWSPKNIDRRCYNYTGIADACDFLFV
Gene ID - Mouse ENSMUSG00000028189
Gene ID - Rat ENSRNOG00000015573
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTBS pAb (ATL-HPA023594)
Datasheet Anti CTBS pAb (ATL-HPA023594) Datasheet (External Link)
Vendor Page Anti CTBS pAb (ATL-HPA023594) at Atlas Antibodies

Documents & Links for Anti CTBS pAb (ATL-HPA023594)
Datasheet Anti CTBS pAb (ATL-HPA023594) Datasheet (External Link)
Vendor Page Anti CTBS pAb (ATL-HPA023594)