Anti CTBP2 pAb (ATL-HPA023564)

Atlas Antibodies

Catalog No.:
ATL-HPA023564-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: C-terminal binding protein 2
Gene Name: CTBP2
Alternative Gene Name: ribeye
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030970: 63%, ENSRNOG00000017326: 62%
Entrez Gene ID: 1488
Uniprot ID: P56545
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPSYGVLGSRTSWDPMQGRSPALQDAGHLYRDPGGKMIPQGRQTQSRAASPGRYGREQPDTRYGAEVPAYPLSQVFSDISERPIDPAP
Gene Sequence VPSYGVLGSRTSWDPMQGRSPALQDAGHLYRDPGGKMIPQGRQTQSRAASPGRYGREQPDTRYGAEVPAYPLSQVFSDISERPIDPAP
Gene ID - Mouse ENSMUSG00000030970
Gene ID - Rat ENSRNOG00000017326
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTBP2 pAb (ATL-HPA023564)
Datasheet Anti CTBP2 pAb (ATL-HPA023564) Datasheet (External Link)
Vendor Page Anti CTBP2 pAb (ATL-HPA023564) at Atlas Antibodies

Documents & Links for Anti CTBP2 pAb (ATL-HPA023564)
Datasheet Anti CTBP2 pAb (ATL-HPA023564) Datasheet (External Link)
Vendor Page Anti CTBP2 pAb (ATL-HPA023564)