Anti CTBP2 pAb (ATL-HPA023564)
Atlas Antibodies
- SKU:
- ATL-HPA023564-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CTBP2
Alternative Gene Name: ribeye
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030970: 63%, ENSRNOG00000017326: 62%
Entrez Gene ID: 1488
Uniprot ID: P56545
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VPSYGVLGSRTSWDPMQGRSPALQDAGHLYRDPGGKMIPQGRQTQSRAASPGRYGREQPDTRYGAEVPAYPLSQVFSDISERPIDPAP |
Gene Sequence | VPSYGVLGSRTSWDPMQGRSPALQDAGHLYRDPGGKMIPQGRQTQSRAASPGRYGREQPDTRYGAEVPAYPLSQVFSDISERPIDPAP |
Gene ID - Mouse | ENSMUSG00000030970 |
Gene ID - Rat | ENSRNOG00000017326 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTBP2 pAb (ATL-HPA023564) | |
Datasheet | Anti CTBP2 pAb (ATL-HPA023564) Datasheet (External Link) |
Vendor Page | Anti CTBP2 pAb (ATL-HPA023564) at Atlas Antibodies |
Documents & Links for Anti CTBP2 pAb (ATL-HPA023564) | |
Datasheet | Anti CTBP2 pAb (ATL-HPA023564) Datasheet (External Link) |
Vendor Page | Anti CTBP2 pAb (ATL-HPA023564) |