Anti CTBP1 pAb (ATL-HPA018987)

Atlas Antibodies

SKU: ATL-HPA018987-25

• 
• 
• 

Protein Description: C-terminal binding protein 1
Gene Name: CTBP1
Alternative Gene Name: BARS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037373: 97%, ENSRNOG00000005428: 95%
Entrez Gene ID: 1487
Uniprot ID: Q13363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
• Gene Sequence: YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
• Gene ID - Mouse: ENSMUSG00000037373
• Gene ID - Rat: ENSRNOG00000005428
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.