Anti CTBP1 pAb (ATL-HPA018987)

Atlas Antibodies

Catalog No.:
ATL-HPA018987-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: C-terminal binding protein 1
Gene Name: CTBP1
Alternative Gene Name: BARS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037373: 97%, ENSRNOG00000005428: 95%
Entrez Gene ID: 1487
Uniprot ID: Q13363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Gene Sequence YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL
Gene ID - Mouse ENSMUSG00000037373
Gene ID - Rat ENSRNOG00000005428
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTBP1 pAb (ATL-HPA018987)
Datasheet Anti CTBP1 pAb (ATL-HPA018987) Datasheet (External Link)
Vendor Page Anti CTBP1 pAb (ATL-HPA018987) at Atlas Antibodies

Documents & Links for Anti CTBP1 pAb (ATL-HPA018987)
Datasheet Anti CTBP1 pAb (ATL-HPA018987) Datasheet (External Link)
Vendor Page Anti CTBP1 pAb (ATL-HPA018987)