Anti CTBP1 pAb (ATL-HPA018987)
Atlas Antibodies
- SKU:
- ATL-HPA018987-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CTBP1
Alternative Gene Name: BARS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037373: 97%, ENSRNOG00000005428: 95%
Entrez Gene ID: 1487
Uniprot ID: Q13363
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
Gene Sequence | YPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEADRDHASDQL |
Gene ID - Mouse | ENSMUSG00000037373 |
Gene ID - Rat | ENSRNOG00000005428 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTBP1 pAb (ATL-HPA018987) | |
Datasheet | Anti CTBP1 pAb (ATL-HPA018987) Datasheet (External Link) |
Vendor Page | Anti CTBP1 pAb (ATL-HPA018987) at Atlas Antibodies |
Documents & Links for Anti CTBP1 pAb (ATL-HPA018987) | |
Datasheet | Anti CTBP1 pAb (ATL-HPA018987) Datasheet (External Link) |
Vendor Page | Anti CTBP1 pAb (ATL-HPA018987) |