Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044208-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CTB-50L17.10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002833: 91%, ENSRNOG00000049142: 92%
Entrez Gene ID: 84717
Uniprot ID: Q7Z4V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKV |
Gene Sequence | KVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAAEVYTRLKSRVLGPKIEAVQKV |
Gene ID - Mouse | ENSMUSG00000002833 |
Gene ID - Rat | ENSRNOG00000049142 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation) | |
Datasheet | Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation) | |
Datasheet | Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CTB-50L17.10 pAb (ATL-HPA044208 w/enhanced validation) |