Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA042559-25

Protein Description: Hepatoma-derived growth factor-related protein 2
Gene Name: CTB-50L17.10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002833: 77%, ENSRNOG00000049142: 78%
Entrez Gene ID: 84717
Uniprot ID: Q7Z4V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
• Gene Sequence: AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
• Gene ID - Mouse: ENSMUSG00000002833
• Gene ID - Rat: ENSRNOG00000049142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.