Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA042559-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: Hepatoma-derived growth factor-related protein 2
Gene Name: CTB-50L17.10
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000002833: 77%, ENSRNOG00000049142: 78%
Entrez Gene ID: 84717
Uniprot ID: Q7Z4V5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
Gene Sequence AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
Gene ID - Mouse ENSMUSG00000002833
Gene ID - Rat ENSRNOG00000049142
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation)
Datasheet Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation)
Datasheet Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CTB-50L17.10 pAb (ATL-HPA042559 w/enhanced validation)