Anti CTAGE5 pAb (ATL-HPA000922)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000922-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CTAGE5
Alternative Gene Name: cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021000: 84%, ENSRNOG00000005101: 84%
Entrez Gene ID: 4253
Uniprot ID: O15320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ |
| Gene Sequence | EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ |
| Gene ID - Mouse | ENSMUSG00000021000 |
| Gene ID - Rat | ENSRNOG00000005101 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000922) at Atlas Antibodies |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000922) |
| Citations for Anti CTAGE5 pAb (ATL-HPA000922) – 1 Found |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |