Anti CTAGE5 pAb (ATL-HPA000922)

Atlas Antibodies

SKU: ATL-HPA000922-25

• 
• 

Protein Description: CTAGE family, member 5
Gene Name: CTAGE5
Alternative Gene Name: cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021000: 84%, ENSRNOG00000005101: 84%
Entrez Gene ID: 4253
Uniprot ID: O15320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ
• Gene Sequence: EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ
• Gene ID - Mouse: ENSMUSG00000021000
• Gene ID - Rat: ENSRNOG00000005101
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CTAGE5 pAb (ATL-HPA000922) – 1 Found

Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.