Anti CTAGE5 pAb (ATL-HPA000922)

Atlas Antibodies

Catalog No.:
ATL-HPA000922-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: CTAGE family, member 5
Gene Name: CTAGE5
Alternative Gene Name: cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021000: 84%, ENSRNOG00000005101: 84%
Entrez Gene ID: 4253
Uniprot ID: O15320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ
Gene Sequence EKEATEAQSLEATCEKLNRSNSELEDEILCLEKELKEEKSKHSEQDELMADISKRIQSLEDESKSLKSQVAEAKMTFKIFQMNEERLKIAIKDALNENSQLQESQKQLLQ
Gene ID - Mouse ENSMUSG00000021000
Gene ID - Rat ENSRNOG00000005101
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922)
Datasheet Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link)
Vendor Page Anti CTAGE5 pAb (ATL-HPA000922) at Atlas Antibodies

Documents & Links for Anti CTAGE5 pAb (ATL-HPA000922)
Datasheet Anti CTAGE5 pAb (ATL-HPA000922) Datasheet (External Link)
Vendor Page Anti CTAGE5 pAb (ATL-HPA000922)
Citations for Anti CTAGE5 pAb (ATL-HPA000922) – 1 Found
Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81.  PubMed