Anti CTAGE5 pAb (ATL-HPA000387)
Atlas Antibodies
- Catalog No.:
- ATL-HPA000387-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CTAGE5
Alternative Gene Name: cTAGE-5A, cTAGE-5B, cTAGE-5C, cTAGE-5D, MEA6, MGEA, MGEA11, MGEA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021000: 95%, ENSRNOG00000005101: 94%
Entrez Gene ID: 4253
Uniprot ID: O15320
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTETELKFELLEKDPYALDV |
| Gene Sequence | NEMKLHRKLTVEENYRLEKEEKLSKVDEKISHATEELETYRKRAKDLEEELERTIHSYQGQIISHEKKAHDNWLAARNAERNLNDLRKENAHNRQKLTETELKFELLEKDPYALDV |
| Gene ID - Mouse | ENSMUSG00000021000 |
| Gene ID - Rat | ENSRNOG00000005101 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000387) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000387) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000387) at Atlas Antibodies |
| Documents & Links for Anti CTAGE5 pAb (ATL-HPA000387) | |
| Datasheet | Anti CTAGE5 pAb (ATL-HPA000387) Datasheet (External Link) |
| Vendor Page | Anti CTAGE5 pAb (ATL-HPA000387) |
| Citations for Anti CTAGE5 pAb (ATL-HPA000387) – 4 Found |
| Fan, Junwan; Wang, Yaqing; Liu, Liang; Zhang, Hongsheng; Zhang, Feng; Shi, Lei; Yu, Mei; Gao, Fei; Xu, Zhiheng. cTAGE5 deletion in pancreatic β cells impairs proinsulin trafficking and insulin biogenesis in mice. The Journal Of Cell Biology. 2017;216(12):4153-4164. PubMed |
| Zhang, Feng; Wang, Yaqing; Wang, Tao; Yao, Li; Lam, Sin Man; Huang, Xiahe; Fan, Junwan; Wang, Qin; Liu, Liang; Jiang, Yisheng; Zhang, Hongsheng; Shi, Lei; Yu, Mei; Shui, Guanghou; Wang, Yingchun; Gao, Fei; Zhang, Xiaohui; Xu, Zhiheng. cTAGE5/MEA6 plays a critical role in neuronal cellular components trafficking and brain development. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2018;115(40):E9449-E9458. PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Falk, Ronny; Ramström, Margareta; Eriksson, Cecilia; Uhlén, Mathias; Wernérus, Henrik; Hober, Sophia. Targeted protein pullout from human tissue samples using competitive elution. Biotechnology Journal. 2011;6(1):28-37. PubMed |