Anti CT83 pAb (ATL-HPA004773)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004773-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CT83
Alternative Gene Name: CXorf61, FLJ20611, FLJ22913, KK-LC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051243: 30%, ENSRNOG00000050714: 30%
Entrez Gene ID: 203413
Uniprot ID: Q5H943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Gene Sequence | QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST |
| Gene ID - Mouse | ENSMUSG00000051243 |
| Gene ID - Rat | ENSRNOG00000050714 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CT83 pAb (ATL-HPA004773) | |
| Datasheet | Anti CT83 pAb (ATL-HPA004773) Datasheet (External Link) |
| Vendor Page | Anti CT83 pAb (ATL-HPA004773) at Atlas Antibodies |
| Documents & Links for Anti CT83 pAb (ATL-HPA004773) | |
| Datasheet | Anti CT83 pAb (ATL-HPA004773) Datasheet (External Link) |
| Vendor Page | Anti CT83 pAb (ATL-HPA004773) |
| Citations for Anti CT83 pAb (ATL-HPA004773) – 1 Found |
| Paret, Claudia; Simon, Petra; Vormbrock, Kirsten; Bender, Christian; Kölsch, Anne; Breitkreuz, Andrea; Yildiz, Özlem; Omokoko, Tana; Hubich-Rau, Stefanie; Hartmann, Christoph; Häcker, Sabine; Wagner, Meike; Roldan, Diana Barea; Selmi, Abderaouf; Türeci, Özlem; Sahin, Ugur. CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer. Oncotarget. 2015;6(28):25356-67. PubMed |