Anti CT83 pAb (ATL-HPA004773)

Atlas Antibodies

Catalog No.:
ATL-HPA004773-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cancer/testis antigen 83
Gene Name: CT83
Alternative Gene Name: CXorf61, FLJ20611, FLJ22913, KK-LC-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051243: 30%, ENSRNOG00000050714: 30%
Entrez Gene ID: 203413
Uniprot ID: Q5H943
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Gene Sequence QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Gene ID - Mouse ENSMUSG00000051243
Gene ID - Rat ENSRNOG00000050714
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CT83 pAb (ATL-HPA004773)
Datasheet Anti CT83 pAb (ATL-HPA004773) Datasheet (External Link)
Vendor Page Anti CT83 pAb (ATL-HPA004773) at Atlas Antibodies

Documents & Links for Anti CT83 pAb (ATL-HPA004773)
Datasheet Anti CT83 pAb (ATL-HPA004773) Datasheet (External Link)
Vendor Page Anti CT83 pAb (ATL-HPA004773)
Citations for Anti CT83 pAb (ATL-HPA004773) – 1 Found
Paret, Claudia; Simon, Petra; Vormbrock, Kirsten; Bender, Christian; Kölsch, Anne; Breitkreuz, Andrea; Yildiz, Özlem; Omokoko, Tana; Hubich-Rau, Stefanie; Hartmann, Christoph; Häcker, Sabine; Wagner, Meike; Roldan, Diana Barea; Selmi, Abderaouf; Türeci, Özlem; Sahin, Ugur. CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer. Oncotarget. 2015;6(28):25356-67.  PubMed