Anti CT55 pAb (ATL-HPA059575)

Atlas Antibodies

Catalog No.:
ATL-HPA059575-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cancer/testis antigen 55
Gene Name: CT55
Alternative Gene Name: CXorf48, FLJ20527
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015365: 46%, ENSRNOG00000031093: 46%
Entrez Gene ID: 54967
Uniprot ID: Q8WUE5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
Gene Sequence GNVPLKVGQKVNVVVEEDKPHYGLRAIKVDVVPRHLYGAGPSDSGTRVLIG
Gene ID - Mouse ENSMUSG00000015365
Gene ID - Rat ENSRNOG00000031093
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CT55 pAb (ATL-HPA059575)
Datasheet Anti CT55 pAb (ATL-HPA059575) Datasheet (External Link)
Vendor Page Anti CT55 pAb (ATL-HPA059575) at Atlas Antibodies

Documents & Links for Anti CT55 pAb (ATL-HPA059575)
Datasheet Anti CT55 pAb (ATL-HPA059575) Datasheet (External Link)
Vendor Page Anti CT55 pAb (ATL-HPA059575)