Anti CT45A1 pAb (ATL-HPA046987)
Atlas Antibodies
- Catalog No.:
- ATL-HPA046987-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CT45A1
Alternative Gene Name: CT45-1, CT45.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022821: 37%, ENSRNOG00000002701: 37%
Entrez Gene ID: 541466
Uniprot ID: Q5HYN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI |
| Gene Sequence | PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI |
| Gene ID - Mouse | ENSMUSG00000022821 |
| Gene ID - Rat | ENSRNOG00000002701 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CT45A1 pAb (ATL-HPA046987) | |
| Datasheet | Anti CT45A1 pAb (ATL-HPA046987) Datasheet (External Link) |
| Vendor Page | Anti CT45A1 pAb (ATL-HPA046987) at Atlas Antibodies |
| Documents & Links for Anti CT45A1 pAb (ATL-HPA046987) | |
| Datasheet | Anti CT45A1 pAb (ATL-HPA046987) Datasheet (External Link) |
| Vendor Page | Anti CT45A1 pAb (ATL-HPA046987) |