Anti CT45A1 pAb (ATL-HPA046987)

Atlas Antibodies

Catalog No.:
ATL-HPA046987-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cancer/testis antigen family 45, member A1
Gene Name: CT45A1
Alternative Gene Name: CT45-1, CT45.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022821: 37%, ENSRNOG00000002701: 37%
Entrez Gene ID: 541466
Uniprot ID: Q5HYN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
Gene Sequence PGSNAPVGGNVTSSFSGDDLECRETASSPKSQREINADI
Gene ID - Mouse ENSMUSG00000022821
Gene ID - Rat ENSRNOG00000002701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CT45A1 pAb (ATL-HPA046987)
Datasheet Anti CT45A1 pAb (ATL-HPA046987) Datasheet (External Link)
Vendor Page Anti CT45A1 pAb (ATL-HPA046987) at Atlas Antibodies

Documents & Links for Anti CT45A1 pAb (ATL-HPA046987)
Datasheet Anti CT45A1 pAb (ATL-HPA046987) Datasheet (External Link)
Vendor Page Anti CT45A1 pAb (ATL-HPA046987)