Anti CT45A1 pAb (ATL-HPA044735 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA044735-25

• 
• 
• 

Protein Description: cancer/testis antigen family 45, member A1
Gene Name: CT45A1
Alternative Gene Name: CT45-1, CT45.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035161: 30%, ENSRNOG00000009873: 30%
Entrez Gene ID: 541466
Uniprot ID: Q5HYN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
• Gene Sequence: TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
• Gene ID - Mouse: ENSMUSG00000035161
• Gene ID - Rat: ENSRNOG00000009873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.