Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA040168-25
  • Immunohistochemical staining of human cerebral cortex, colon, epididymis and testis using Anti-CSTF3 antibody HPA040168 (A) shows similar protein distribution across tissues to independent antibody HPA039743 (B).
  • Western blot analysis using Anti-CSTF3 antibody HPA040168 (A) shows similar pattern to independent antibody HPA039743 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cleavage stimulation factor, 3' pre-RNA, subunit 3, 77kDa
Gene Name: CSTF3
Alternative Gene Name: CstF-77
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027176: 100%, ENSRNOG00000012089: 99%
Entrez Gene ID: 1479
Uniprot ID: Q12996
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen QLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHH
Gene Sequence QLWRDYNKYEEGINIHLAKKMIEDRSRDYMNARRVAKEYETVMKGLDRNAPSVPPQNTPQEAQQVDMWKKYIQWEKSNPLRTEDQTLITKRVMFAYEQCLLVLGHH
Gene ID - Mouse ENSMUSG00000027176
Gene ID - Rat ENSRNOG00000012089
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation)
Datasheet Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation)
Datasheet Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CSTF3 pAb (ATL-HPA040168 w/enhanced validation)