Anti CSTF1 pAb (ATL-HPA047275)

Atlas Antibodies

Catalog No.:
ATL-HPA047275-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cleavage stimulation factor, 3' pre-RNA, subunit 1, 50kDa
Gene Name: CSTF1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027498: 100%, ENSRNOG00000004775: 100%
Entrez Gene ID: 1477
Uniprot ID: Q05048
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS
Gene Sequence TGSADASIKILDTERMLAKSAMPIEVMMNETAQQNMENHPVIRTLYDHVDEVTCLAFHPTEQILASGSRDYTLKLFDYSKPSAKRAFKYIQEAEMLRSIS
Gene ID - Mouse ENSMUSG00000027498
Gene ID - Rat ENSRNOG00000004775
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CSTF1 pAb (ATL-HPA047275)
Datasheet Anti CSTF1 pAb (ATL-HPA047275) Datasheet (External Link)
Vendor Page Anti CSTF1 pAb (ATL-HPA047275) at Atlas Antibodies

Documents & Links for Anti CSTF1 pAb (ATL-HPA047275)
Datasheet Anti CSTF1 pAb (ATL-HPA047275) Datasheet (External Link)
Vendor Page Anti CSTF1 pAb (ATL-HPA047275)