Anti CSTB pAb (ATL-HPA017380 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017380-25

• 
• 
• 

Protein Description: cystatin B (stefin B)
Gene Name: CSTB
Alternative Gene Name: CST6, EPM1, PME, STFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005054: 76%, ENSRNOG00000001201: 76%
Entrez Gene ID: 1476
Uniprot ID: P04080
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT
• Gene Sequence: QVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELT
• Gene ID - Mouse: ENSMUSG00000005054
• Gene ID - Rat: ENSRNOG00000001201
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CSTB pAb (ATL-HPA017380 w/enhanced validation) – 3 Found

Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. 

Santana-Rivera, Yasmarie; Rabelo-Fernández, Robert J; Quiñones-Díaz, Blanca I; Grafals-Ruíz, Nilmary; Santiago-Sánchez, Ginette; Lozada-Delgado, Eunice L; Echevarría-Vargas, Ileabett M; Apiz, Juan; Soto, Daniel; Rosado, Andrea; Meléndez, Loyda; Valiyeva, Fatima; Vivas-Mejía, Pablo E. Reduced expression of enolase-1 correlates with high intracellular glucose levels and increased senescence in cisplatin-resistant ovarian cancer cells. American Journal Of Translational Research. 12(4):1275-1292. 

Lucchino, Valeria; Scaramuzzino, Luana; Scalise, Stefania; Lo Conte, Michela; Zannino, Clara; Benedetto, Giorgia Lucia; Aguglia, Umberto; Ferlazzo, Edoardo; Cuda, Giovanni; Parrotta, Elvira Immacolata. Insights into the Genetic Profile of Two Siblings Affected by Unverricht-Lundborg Disease Using Patient-Derived hiPSCs. Cells. 2022;11(21)