Anti CSTA pAb (ATL-HPA001031 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001031-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CSTA
Alternative Gene Name: STF1, STFA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034339: 60%, ENSRNOG00000050110: 65%
Entrez Gene ID: 1475
Uniprot ID: P01040
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV |
| Gene Sequence | IPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLV |
| Gene ID - Mouse | ENSMUSG00000034339 |
| Gene ID - Rat | ENSRNOG00000050110 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) | |
| Datasheet | Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) | |
| Datasheet | Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) |
| Citations for Anti CSTA pAb (ATL-HPA001031 w/enhanced validation) – 6 Found |
| Kudo, Itsuhiro; Esumi, Mariko; Kusumi, Yoshiaki; Furusaka, Tohru; Oshima, Takeshi. Particular gene upregulation and p53 heterogeneous expression in TP53-mutated maxillary carcinoma. Oncology Letters. 2017;14(4):4633-4640. PubMed |
| Ek, Sara; Andréasson, Ulrika; Hober, Sophia; Kampf, Caroline; Pontén, Fredrik; Uhlén, Mathias; Merz, Hartmut; Borrebaeck, Carl A K. From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies. Molecular & Cellular Proteomics : Mcp. 2006;5(6):1072-81. PubMed |
| Asplund, A; Gry Björklund, M; Sundquist, C; Strömberg, S; Edlund, K; Ostman, A; Nilsson, P; Pontén, F; Lundeberg, J. Expression profiling of microdissected cell populations selected from basal cells in normal epidermis and basal cell carcinoma. The British Journal Of Dermatology. 2008;158(3):527-38. PubMed |
| Shiba, Daiki; Terayama, Masayoshi; Yamada, Kazuhiko; Hagiwara, Teruki; Oyama, Chinatsu; Tamura-Nakano, Miwa; Igari, Toru; Yokoi, Chizu; Soma, Daisuke; Nohara, Kyoko; Yamashita, Satoshi; Dohi, Taeko; Kawamura, Yuki I. Clinicopathological significance of cystatin A expression in progression of esophageal squamous cell carcinoma. Medicine. 2018;97(15):e0357. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Chumduri, Cindrilla; Gurumurthy, Rajendra Kumar; Berger, Hilmar; Dietrich, Oliver; Kumar, Naveen; Koster, Stefanie; Brinkmann, Volker; Hoffmann, Kirstin; Drabkina, Marina; Arampatzi, Panagiota; Son, Dajung; Klemm, Uwe; Mollenkopf, Hans-Joachim; Herbst, Hermann; Mangler, Mandy; Vogel, Jörg; Saliba, Antoine-Emmanuel; Meyer, Thomas F. Opposing Wnt signals regulate cervical squamocolumnar homeostasis and emergence of metaplasia. Nature Cell Biology. 2021;23(2):184-197. PubMed |