Anti CST7 pAb (ATL-HPA040442 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040442-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CST7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068129: 75%, ENSRNOG00000006767: 76%
Entrez Gene ID: 8530
Uniprot ID: O76096
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH |
| Gene Sequence | VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH |
| Gene ID - Mouse | ENSMUSG00000068129 |
| Gene ID - Rat | ENSRNOG00000006767 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) | |
| Datasheet | Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) | |
| Datasheet | Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) |
| Citations for Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) – 3 Found |
| Nuvolone, Mario; Schmid, Nicolas; Miele, Gino; Sorce, Silvia; Moos, Rita; Schori, Christian; Beerli, Roger R; Bauer, Monika; Saudan, Philippe; Dietmeier, Klaus; Lachmann, Ingolf; Linnebank, Michael; Martin, Roland; Kallweit, Ulf; Kana, Veronika; Rushing, Elisabeth J; Budka, Herbert; Aguzzi, Adriano. Cystatin F is a biomarker of prion pathogenesis in mice. Plos One. 12(2):e0171923. PubMed |
| Perišić Nanut, Milica; Sabotič, Jerica; Švajger, Urban; Jewett, Anahid; Kos, Janko. Cystatin F Affects Natural Killer Cell Cytotoxicity. Frontiers In Immunology. 8( 29180998):1459. PubMed |
| Mitrović, Ana; Senjor, Emanuela; Jukić, Marko; Bolčina, Lara; Prunk, Mateja; Proj, Matic; Nanut, Milica Perišić; Gobec, Stanislav; Kos, Janko. New inhibitors of cathepsin V impair tumor cell proliferation and elastin degradation and increase immune cell cytotoxicity. Computational And Structural Biotechnology Journal. 20( 36147668):4667-4687. PubMed |