Anti CST7 pAb (ATL-HPA040442 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040442-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cystatin F (leukocystatin)
Gene Name: CST7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068129: 75%, ENSRNOG00000006767: 76%
Entrez Gene ID: 8530
Uniprot ID: O76096
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Gene Sequence VKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCH
Gene ID - Mouse ENSMUSG00000068129
Gene ID - Rat ENSRNOG00000006767
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CST7 pAb (ATL-HPA040442 w/enhanced validation)
Datasheet Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CST7 pAb (ATL-HPA040442 w/enhanced validation)
Datasheet Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CST7 pAb (ATL-HPA040442 w/enhanced validation)
Citations for Anti CST7 pAb (ATL-HPA040442 w/enhanced validation) – 3 Found
Nuvolone, Mario; Schmid, Nicolas; Miele, Gino; Sorce, Silvia; Moos, Rita; Schori, Christian; Beerli, Roger R; Bauer, Monika; Saudan, Philippe; Dietmeier, Klaus; Lachmann, Ingolf; Linnebank, Michael; Martin, Roland; Kallweit, Ulf; Kana, Veronika; Rushing, Elisabeth J; Budka, Herbert; Aguzzi, Adriano. Cystatin F is a biomarker of prion pathogenesis in mice. Plos One. 12(2):e0171923.  PubMed
Perišić Nanut, Milica; Sabotič, Jerica; Švajger, Urban; Jewett, Anahid; Kos, Janko. Cystatin F Affects Natural Killer Cell Cytotoxicity. Frontiers In Immunology. 8( 29180998):1459.  PubMed
Mitrović, Ana; Senjor, Emanuela; Jukić, Marko; Bolčina, Lara; Prunk, Mateja; Proj, Matic; Nanut, Milica Perišić; Gobec, Stanislav; Kos, Janko. New inhibitors of cathepsin V impair tumor cell proliferation and elastin degradation and increase immune cell cytotoxicity. Computational And Structural Biotechnology Journal. 20( 36147668):4667-4687.  PubMed