Anti CST6 pAb (ATL-HPA044963 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044963-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CST6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024846: 72%, ENSRNOG00000020455: 74%
Entrez Gene ID: 1474
Uniprot ID: Q15828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH |
| Gene Sequence | SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH |
| Gene ID - Mouse | ENSMUSG00000024846 |
| Gene ID - Rat | ENSRNOG00000020455 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) | |
| Datasheet | Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) | |
| Datasheet | Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) |