Anti CST6 pAb (ATL-HPA044963 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA044963-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cystatin E/M
Gene Name: CST6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024846: 72%, ENSRNOG00000020455: 74%
Entrez Gene ID: 1474
Uniprot ID: Q15828
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH
Gene Sequence SNSIYYFRDTHIIKAQSQLVAGIKYFLTMEMGSTDCRKTRVTGDHVDLTTCPLAAGAQQEKLRCDFEVLVVPWQNSSQLLKH
Gene ID - Mouse ENSMUSG00000024846
Gene ID - Rat ENSRNOG00000020455
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CST6 pAb (ATL-HPA044963 w/enhanced validation)
Datasheet Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CST6 pAb (ATL-HPA044963 w/enhanced validation)
Datasheet Anti CST6 pAb (ATL-HPA044963 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CST6 pAb (ATL-HPA044963 w/enhanced validation)