Anti CST11 pAb (ATL-HPA053399 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA053399-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cystatin 11
Gene Name: CST11
Alternative Gene Name: CST8L, CTES2, dJ322G13.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036958: 49%, ENSRNOG00000004808: 49%
Entrez Gene ID: 140880
Uniprot ID: Q9H112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV
Gene Sequence YQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV
Gene ID - Mouse ENSMUSG00000036958
Gene ID - Rat ENSRNOG00000004808
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CST11 pAb (ATL-HPA053399 w/enhanced validation)
Datasheet Anti CST11 pAb (ATL-HPA053399 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CST11 pAb (ATL-HPA053399 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CST11 pAb (ATL-HPA053399 w/enhanced validation)
Datasheet Anti CST11 pAb (ATL-HPA053399 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CST11 pAb (ATL-HPA053399 w/enhanced validation)
Citations for Anti CST11 pAb (ATL-HPA053399 w/enhanced validation) – 1 Found
Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11)  PubMed