Anti CST11 pAb (ATL-HPA053399 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA053399-25

Protein Description: cystatin 11
Gene Name: CST11
Alternative Gene Name: CST8L, CTES2, dJ322G13.6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036958: 49%, ENSRNOG00000004808: 49%
Entrez Gene ID: 140880
Uniprot ID: Q9H112
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV
• Gene Sequence: YQARKKTFLSVHEVMAVENYAKDSLQWITDQYNKESDDKYHFRIFRV
• Gene ID - Mouse: ENSMUSG00000036958
• Gene ID - Rat: ENSRNOG00000004808
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CST11 pAb (ATL-HPA053399 w/enhanced validation) – 1 Found

Leir, Shih-Hsing; Yin, Shiyi; Kerschner, Jenny L; Cosme, Wilmel; Harris, Ann. An atlas of human proximal epididymis reveals cell-specific functions and distinct roles for CFTR. Life Science Alliance. 2020;3(11)