Anti CSRNP2 pAb (ATL-HPA019914)

Atlas Antibodies

SKU: ATL-HPA019914-25

• 
• 

Protein Description: cysteine-serine-rich nuclear protein 2
Gene Name: CSRNP2
Alternative Gene Name: C12ORF2, C12orf22, FAM130A1, PPP1R72, TAIP-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044636: 88%, ENSRNOG00000019653: 88%
Entrez Gene ID: 81566
Uniprot ID: Q9H175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKG
• Gene Sequence: GVCILEEPLAVPEELCPGLTAPILIQAQLPPGSSVLCFTENSDHPTASTVNSPSYLNSGPLVYYQVEQRPVLGVKG
• Gene ID - Mouse: ENSMUSG00000044636
• Gene ID - Rat: ENSRNOG00000019653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.