Anti CSRNP2 pAb (ATL-HPA018503 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA018503-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and CSRNP2 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY410704).
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cysteine-serine-rich nuclear protein 2
Gene Name: CSRNP2
Alternative Gene Name: C12ORF2, C12orf22, FAM130A1, PPP1R72, TAIP-12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044636: 87%, ENSRNOG00000019653: 87%
Entrez Gene ID: 81566
Uniprot ID: Q9H175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Gene Sequence FNPIRVRTHYLHTIMKLELESKRQVSRPAAPDEEPSPTASCSLTGAQGSETQDFQEFIAENETAVMHLQSAEELERLKAEEDSSGSSAS
Gene ID - Mouse ENSMUSG00000044636
Gene ID - Rat ENSRNOG00000019653
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti CSRNP2 pAb (ATL-HPA018503 w/enhanced validation)
Datasheet Anti CSRNP2 pAb (ATL-HPA018503 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CSRNP2 pAb (ATL-HPA018503 w/enhanced validation)