Anti CSRNP1 pAb (ATL-HPA058463)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058463-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CSRNP1
Alternative Gene Name: AXUD1, DKFZp566F164, FAM130B, TAIP-3, URAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032515: 76%, ENSRNOG00000033433: 79%
Entrez Gene ID: 64651
Uniprot ID: Q96S65
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS |
Gene Sequence | FAQEQARARHEKLRQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVS |
Gene ID - Mouse | ENSMUSG00000032515 |
Gene ID - Rat | ENSRNOG00000033433 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CSRNP1 pAb (ATL-HPA058463) | |
Datasheet | Anti CSRNP1 pAb (ATL-HPA058463) Datasheet (External Link) |
Vendor Page | Anti CSRNP1 pAb (ATL-HPA058463) at Atlas Antibodies |
Documents & Links for Anti CSRNP1 pAb (ATL-HPA058463) | |
Datasheet | Anti CSRNP1 pAb (ATL-HPA058463) Datasheet (External Link) |
Vendor Page | Anti CSRNP1 pAb (ATL-HPA058463) |